FAM49B antibody
| Name | FAM49B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331906 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-FAM49B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM49B. Synthetic peptide located within the following region: ILYDHVHPVGAFAKTSKIDMKGCIKVLKDQPPNSVEGLLNALRYTTKHLN. |
| Description | Rabbit Polyclonal |
| Gene | FAM49B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM49B; Sample Tissue: HT1080 Whole Cell lysates; Antibody Dilution: 1.0ug/ml