FAM83E antibody
| Name | FAM83E antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA344971 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Rat |
| Antigen | The immunogen for anti-FAM83E antibody: synthetic peptide directed towards the middle region of human FAM83E. Synthetic peptide located within the following region: RARTPSGPPARPSRSMWDLSRLSQLSGSSDGDNELKKSWGSKDTPAKALM. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM83E |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FAM83E Antibody Titration: 0.2-1 ug/ml; Positive Control: NCI-H226 cell lysateFAM83E is supported by BioGPS gene expression data to be expressed in NCIH226