FAM92B antibody

Name FAM92B antibody
Supplier Acris Antibodies
Catalog TA333366
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-FAM92B Antibody: synthetic peptide directed towards the N terminal of human FAM92B. Synthetic peptide located within the following region: FAEDLAKVQDYRQAQVERLETKVVNPLKLYGAQIKQTRAEIKKFKHVQNH.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM92B
Supplier Page Shop

Product images