FAM102B antibody

Name FAM102B antibody
Supplier Acris Antibodies
Catalog TA336127
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-FAM102B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM102B. Synthetic peptide located within the following region: SQQSKVSGYSTCHSRSSSFSELCHRRNTSVGSTSTGVESILEPCDEIEQK.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM102B
Supplier Page Shop

Product images