FAM108B1 antibody
| Name | FAM108B1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA345082 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Pig, Rabbit, Zebrafish |
| Antigen | The immunogen for anti-FAM108B1 antibody: synthetic peptide directed towards the middle region of human FAM108B1. Synthetic peptide located within the following region: SSFYIGLGSRINCNIFSYDYSGYGASSGKPTEKNLYADIEAAWLALRTRY. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | ABHD17B |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FAM108B1 Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human brain