FAM110C antibody
| Name | FAM110C antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332224 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-FAM110C Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM110C. Synthetic peptide located within the following region: DSLIIYRQKCEFVRGSGADGPRASLVKKLFQGPGKDKAPVPRTGDEGKAG. |
| Description | Rabbit Polyclonal |
| Gene | FAM110C |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM110C; Sample Tissue: Fetal Liver lysates; Antibody Dilution: 1.0ug/ml