FAM115A antibody

Name FAM115A antibody
Supplier Acris Antibodies
Catalog TA335880
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Human, Pig, Rabbit, Rat
Antigen The immunogen for Anti-FAM115A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM115A. Synthetic peptide located within the following region: FTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVAT.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene TCAF1
Supplier Page Shop

Product images