FAM116B antibody

Name FAM116B antibody
Supplier Acris Antibodies
Catalog TA336198
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Rabbit, Rat
Antigen The immunogen for Anti-DENND6B Antibody is: synthetic peptide directed towards the N-terminal region of Human DENND6B. Synthetic peptide located within the following region: PVALQREPAHYFGYVYFRQVKDSSVKRGYFQKSLVLVSRLPFVRLFQALL.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene DENND6B
Supplier Page Shop

Product images