FAM118A antibody
| Name | FAM118A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335911 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Guinea Pig, Rat |
| Antigen | The immunogen for Anti-FAM118A Antibody: synthetic peptide directed towards the middle region of human FAM118A. Synthetic peptide located within the following region: EVMEVLQNLYRTKSFLFVGCGETLRDQIFQALFLYSVPNKVDLEHYMLVL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM118A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FAM118A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:312500; Positive Control: Human heart