FAM124A antibody
| Name | FAM124A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331650 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-FAM124A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM124A. Synthetic peptide located within the following region: PLLPNPCSPISEGRWQTEDHDGNKILLQVLGGRLSVCLGDLRNQLALPQT. |
| Description | Rabbit Polyclonal |
| Gene | FAM124A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM124A; Sample Tissue: Jurkat Whole cell lysates; Antibody Dilution: 1.0ug/ml