FAM124A antibody
| Name | FAM124A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333505 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-FAM124A Antibody: synthetic peptide directed towards the middle region of human FAM124A. Synthetic peptide located within the following region: VSRVTTEASWASLPFFTKRSSSSSATARAAPPAPSTSTLTDSSPQLPCDT. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM124A |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FAM124A Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1: 312500; Positive Control: 293T cell lysate