FAM127B antibody
| Name | FAM127B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330867 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-FAM127B antibody is: synthetic peptide directed towards the N-terminal region of Human FAM127B. Synthetic peptide located within the following region: GRVQLMKALLAGPLRPAARRWRNPIPFPETFDGDTDRLPEFIVQTSSYMF. |
| Description | Rabbit Polyclonal |
| Gene | FAM127B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM127B; Sample Tissue: MDA-MB-435s Whole Cell lysates; Antibody Dilution: 1.0ug/mlFAM127B is supported by BioGPS gene expression data to be expressed in MDA-MB435