FAM131C antibody
| Name | FAM131C antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333388 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat, Zebrafish |
| Antigen | The immunogen for Anti-FAM131C Antibody: synthetic peptide directed towards the middle region of human FAM131C. Synthetic peptide located within the following region: RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM131C |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FAM131C Antibody Titration: 0.2-1 ug/ml; ELISA Titer: 1:12500; Positive Control: 721_B cell lysate