FAM134A antibody
| Name | FAM134A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA338650 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-FAM134A antibody: synthetic peptide directed towards the N terminal of human FAM134A. Synthetic peptide located within the following region: AGSGARPHLLSVPELCRYLAESWLTFQIHLQELLQYKRQNPAQFCVRVCS. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | FAM134A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM134A; Sample Tissue: Human Fetal Heart; Antibody Dilution: 1.0 ug/ml