FAM167A antibody

Name FAM167A antibody
Supplier Acris Antibodies
Catalog TA343220
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for anti-FAM167A antibody is: synthetic peptide directed towards the C-terminal region of Human FAM167A. Synthetic peptide located within the following region: GDINKLKIEHTCRLHRRMLNDATYELEERDELADLFCDSPLASSFSLSTP.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM167A
Supplier Page Shop

Product images