FAM172A antibody
| Name | FAM172A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332168 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Mouse, Rabbit, Rat, Yeast |
| Antigen | The immunogen for Anti-FAM172A Antibody is: synthetic peptide directed towards the middle region of Human FAM172A. Synthetic peptide located within the following region: SSDSSDEPAEKRERKDKVSKETKKRRDFYEKYRNPQREKEMMQLYIRENG. |
| Description | Rabbit Polyclonal |
| Gene | FAM172A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM172A; Sample Tissue: Fetal Kidney lysates; Antibody Dilution: 1.0ug/ml