FAM177B antibody

Name FAM177B antibody
Supplier Acris Antibodies
Catalog TA335326
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-FAM177B Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM177B. Synthetic peptide located within the following region: YRIQNKKSDNKSERRGSKAQAAEVPNEKCHLEAGVQEYGTIQQDVTEAIP.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM177B
Supplier Page Shop

Product images