FAM181B antibody

Name FAM181B antibody
Supplier Acris Antibodies
Catalog TA335361
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Human, Mouse, Pig, Rat, Zebrafish
Antigen The immunogen for Anti-FAM181B Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM181B. Synthetic peptide located within the following region: LSGAEGGDVREATRDLLSFIDSASSNIKLALDKPGKSKRKVNHRKYLQKQ.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM181B
Supplier Page Shop

Product images