FAM184A antibody

Name FAM184A antibody
Supplier Acris Antibodies
Catalog TA335467
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Pig, Rat
Antigen The immunogen for Anti-FAM184A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM184A. Synthetic peptide located within the following region: TNFNKVFNSSPTVGVINPLAKQKKKNDKSPTNRFVSVPNLSALESGGVGN.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM184A
Supplier Page Shop

Product images