FAM188B antibody
| Name | FAM188B antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335431 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Rabbit |
| Antigen | The immunogen for Anti-FAM188B Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM188B. Synthetic peptide located within the following region: HSEPSLDVKRMGENSRPKSGLIVRGMMSGPIASSPQDSFHRHYLRRSSPS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM188B |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM188B; Sample Tissue: Hela Whole cell lysates; Antibody Dilution: 1.0 ug/ml