Name | FAM188B antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA335431 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Horse, Guinea Pig, Human, Rabbit |
Antigen | The immunogen for Anti-FAM188B Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM188B. Synthetic peptide located within the following region: HSEPSLDVKRMGENSRPKSGLIVRGMMSGPIASSPQDSFHRHYLRRSSPS. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | FAM188B |
Supplier Page | Shop |