FAM193A antibody
| Name | FAM193A antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA335763 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Human, Mouse, Rat, Zebrafish |
| Antigen | The immunogen for Anti-FAM193A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM193A. Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FAM193A |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: FAM193A; Sample Tissue: 293T Whole Cell lysates; Antibody Dilution: 1.0 ug/m. lFAM193A is supported by BioGPS gene expression data to be expressed in HEK293T