FAM193A antibody

Name FAM193A antibody
Supplier Acris Antibodies
Catalog TA335763
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Dog, Horse, Human, Mouse, Rat, Zebrafish
Antigen The immunogen for Anti-FAM193A Antibody is: synthetic peptide directed towards the C-terminal region of Human FAM193A. Synthetic peptide located within the following region: EHQQNSKLVLAESPQPKGKNKKNKKKKGDRVNNSIDGVSLLLPSLGYNGA.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM193A
Supplier Page Shop

Product images