FAM221B antibody

Name FAM221B antibody
Supplier Acris Antibodies
Catalog TA334902
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-FAM221B antibody is synthetic peptide directed towards the C-terminal region of Human FAM221B. Synthetic peptide located within the following region: TGPHPCRHHGCCCGCFESNFLCAACDRRWEEHETFFDTQKTRQRGGRPRG.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM221B
Supplier Page Shop

Product images