FAM222A antibody

Name FAM222A antibody
Supplier Acris Antibodies
Catalog TA333598
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Antigen The immunogen for Anti-FAM222A Antibody is: synthetic peptide directed towards the N-terminal region of Human FAM222A. Synthetic peptide located within the following region: PQHTAGYQGLLAIVKAAVSSSSTAAPAGPAKSVLKSAEGKRTKLSPAAVQ.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene FAM222A
Supplier Page Shop

Product images