Name | FAM222B antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA330691 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
Antigen | The immunogen for Anti-FAM222B antibody is: synthetic peptide directed towards the C-terminal region of Human FAM222B. Synthetic peptide located within the following region: VNGMAAPLAYPNGHYFQPLWNNILPTPNSDSSGSQDLAMPFHGGQPTGAP. |
Description | Rabbit Polyclonal |
Gene | FAM222B |
Supplier Page | Shop |