Fat-inducing protein 1 / FIT1 antibody
| Name | Fat-inducing protein 1 / FIT1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337625 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | Synthetic peptide directed towards the N terminal of human FITM1. Synthetic peptide located within the following region: MERGPVVGAGLGAGARIQALLGCLLKVLLWVASALLYFGSEQAARLLGSP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FITM1 |
| Supplier Page | Shop |
Product images
LOC161247 Antibody (against the N terminal of LOC161247) (50ug) validated by WB using Fetal liver cell lysate at 0.2-1 ug/ml.