FLJ37543 antibody

Name FLJ37543 antibody
Supplier Acris Antibodies
Catalog TA331409
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for anti-FLJ37543 antibody: synthetic peptide directed towards the middle region of human FLJ37543. Synthetic peptide located within the following region: PAVFYNQYFKHPKCVGEYGPKNGAERQIEERKVLPTTMMFSMLADCVLKS.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene C5orf64
Supplier Page Shop

Product images