FOXL2NB / C3orf72 antibody
| Name | FOXL2NB / C3orf72 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334911 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for anti-C3orf72 antibody is: synthetic peptide directed towards the N-terminal region of Human C3orf72. Synthetic peptide located within the following region: PKMCLHMAVRHSKAQKTGPGILQQRQKPPAPRASGGPALLGKRRGCSEAG. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | FOXL2NB |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: C3orf72; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml