FOXO6 antibody
| Name | FOXO6 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331437 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Guinea Pig, Human, Mouse, Rat |
| Antigen | The immunogen for anti-FOXO6 antibody: synthetic peptide corresponding to a region of Mouse. Synthetic peptide located within the following region: KTPRRRAVSMDNGAKFLRIKGKASKKKQLHLPERSPDDSPPGAPVPGPLS. |
| Description | Rabbit Polyclonal |
| Gene | Foxo6 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-FOXO6 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:62500; Positive Control: SP2/0 cell lysate