FRMD6 antibody

Name FRMD6 antibody
Supplier Acris Antibodies
Catalog TA338816
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-Frmd6 antibody is: synthetic peptide directed towards the C-terminal region of Rat Frmd6. Synthetic peptide located within the following region: PQTICRKPKTSTDRHSLSLDDIRLYQKDFLRIAGLCQDTAQSYTFGCGHE.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene Frmd6
Supplier Page Shop

Product images