GAL3ST3 antibody

Name GAL3ST3 antibody
Supplier Acris Antibodies
Catalog TA339640
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat
Antigen The immunogen for anti-GAL3ST3 antibody: synthetic peptide directed towards the C terminal of human GAL3ST3. Synthetic peptide located within the following region: VDIMGYDLPGGGAGPATEACLKLAMPEVQYSNYLLRKQKRRGGARARPEP.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene GAL3ST3
Supplier Page Shop

Product images