GALNT3 antibody
| Name | GALNT3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA339418 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-Galnt3 antibody: synthetic peptide corresponding to a region of Rat. Synthetic peptide located within the following region: PERPCLQGYYTAAELKPVLDRPPQDSNAPGASGKPFKITHLSPEEQKEKE. |
| Purity/Format | Protein A purified |
| Description | Rabbit Polyclonal |
| Gene | Galnt3 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Galnt3 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Brain