GALNTL1 antibody

Name GALNTL1 antibody
Supplier Acris Antibodies
Catalog TA338430
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for anti-GALNT16 antibody: synthetic peptide directed towards the N terminal of human GALNT16. Synthetic peptide located within the following region: LSAKQLKAGEDPYRQHAFNQLESDKLSPDRPIRDTRHYSCPSVSYSSDLP.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene GALNT16
Supplier Page Shop

Product images