GALNTL6 / GALNT17 antibody
| Name | GALNTL6 / GALNT17 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA336022 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Mouse, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for Anti-GALNTL6 Antibody is: synthetic peptide directed towards the N-terminal region of Human GALNTL6. Synthetic peptide located within the following region: EEDHDDSAYRENGFNIFVSNNIALERSLPDIRHANCKHKMYLERLPNTSI. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | GALNTL6 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: GALNTL6; Sample Tissue: THP-1 Whole cell lysates; Antibody Dilution: 1.0 ug/ml