Gamma-crystallin N / CRYGN antibody
| Name | Gamma-crystallin N / CRYGN antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA333508 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-CRYGN Antibody is: synthetic peptide directed towards the C-terminal region of Human CRYGN. Synthetic peptide located within the following region: SRGWVKNCVNTIKVYGDGAAWSPRSFGAEDFQLSSSLQSDQGPEEATTKP. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | CRYGN |
| Supplier Page | Shop |
Product images
WB Suggested Anti-CRYGN Antibody; Titration: 1.0 ug/ml; Positive Control: Hela Whole cell