GPATCH2L antibody
| Name | GPATCH2L antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA330688 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat |
| Antigen | The immunogen for Anti-GPATCH2L antibody is: synthetic peptide directed towards the middle region of Human GPATCH2L. Synthetic peptide located within the following region: SRWKENTPWTSSGHGLCESAENRTFLSKTGRKERMECETDEQKQGSDENM. |
| Description | Rabbit Polyclonal |
| Gene | GPATCH2L |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: GPATCH2L; Sample Tissue: Fetal Brain lysates; Antibody Dilution: 1.0ug/ml