GPR141 antibody
| Name | GPR141 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331550 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human, Rabbit |
| Antigen | The immunogen for Anti-GPR141 Antibody is: synthetic peptide directed towards the middle region of Human GPR141. Synthetic peptide located within the following region: DKVEFYRKLHAVAASAGMWTLVIVIVVPLVVSRYGIHEEYNEEHCFKFHK. |
| Description | Rabbit Polyclonal |
| Gene | GPR141 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: GPR141; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml