HEATR6 / ABC1 antibody
| Name | HEATR6 / ABC1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337340 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Rabbit, Rat |
| Antigen | The immunogen for Anti-HEATR6 antibody is: synthetic peptide directed towards the C-terminal region of Human HEATR6. Synthetic peptide located within the following region: YPTPLPQYDGRTPIKPQQSESSASRPTLNKKKKSKVKPKKIQQGEEEEKE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | HEATR6 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: HEATR6; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0 ug/ml