Histone H2B type 1-K antibody
| Name | Histone H2B type 1-K antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343083 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for anti-HIST1H2BK antibody: synthetic peptide directed towards the N terminal of human HIST1H2BK. Synthetic peptide located within the following region: KKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFER. |
| Description | Rabbit Polyclonal |
| Gene | HIST1H2BK |
| Supplier Page | Shop |
Product images
WB Suggested Anti-HIST1H2BK Antibody; Titration: 1.0 ug/ml; Positive Control: Fetal Liver