HNRNPA1L2 antibody
| Name | HNRNPA1L2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA345730 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | IHC-P WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat, Zebrafish |
| Antigen | The immunogen for anti-RP11-78J21.1 antibody: synthetic peptide directed towards the N terminal of human RP11-78J21.1. Synthetic peptide located within the following region: MSKSASPKEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTDCVVMRDPN. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | HNRNPA1L2 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-RP11-78J21.1 Antibody Titration: 0.2-1 ug/ml; Positive Control: Jurkat cell lysate.HNRNPA1L2 is strongly supported by BioGPS gene expression data to be expressed in Human Jurkat cells