HOXD9 / HOX4C antibody
| Name | HOXD9 / HOX4C antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA343721 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-Hoxd9 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hoxd9. Synthetic peptide located within the following region: MSSSGTLSNYYVDSLIGHEGDEVFAARFGPPGPGTQGRPAGVADGPAAAA. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Hoxd9 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-Hoxd9 Antibody; Titration: 1.0 ug/ml; Positive Control: Rat Thymus