IBA57 antibody
| Name | IBA57 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA332270 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Human, Mouse, Pig, Rat |
| Antigen | The immunogen for Anti-IBA57 Antibody is: synthetic peptide directed towards the N-terminal region of Human IBA57. Synthetic peptide located within the following region: ILYGLQEHSEVSGFLLECDSSVQGALQKHLALYRIRRKVTVEPHPELRVW. |
| Description | Rabbit Polyclonal |
| Gene | IBA57 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: IBA57; Sample Tissue: 721_B Whole Cell lysates; Antibody Dilution: 1.0ug/ml