| Name | IER3IP1 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA341995 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Goat, Human, Mouse, Pig, Rabbit, Rat, Yeast, Zebrafish |
| Antigen | The immunogen for Anti-Hdhd2 antibody is: synthetic peptide directed towards the N-terminal region of Rat Hdhd2. Synthetic peptide located within the following region: LMQAALLCVNAIAVLHEERFLKNIGWGTDQGIGGFGEEPGIKSQLLNLIR. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | IER3IP1 |
| Supplier Page | Shop |