IGLON5 antibody
| Name | IGLON5 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA337350 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
| Antigen | The immunogen for Anti-IGLON5 antibody is: synthetic peptide directed towards the C-terminal region of Human IGLON5. Synthetic peptide located within the following region: AALLRCEAMAVPPADFQWYKDDRLLSSGTAEGLKVQTERTRSMLLFANVS. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | IGLON5 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: IGLON5; Sample Tissue: 721_B Whole cell lysates; Antibody Dilution: 1.0 ug/ml