INO80C antibody

Name INO80C antibody
Supplier Acris Antibodies
Catalog TA337356
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat
Antigen The immunogen for Anti-INO80C antibody is: synthetic peptide directed towards the N-terminal region of Human INO80C. Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene INO80C
Supplier Page Shop

Product images