Name | INO80C antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA337356 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rabbit, Rat |
Antigen | The immunogen for Anti-INO80C antibody is: synthetic peptide directed towards the N-terminal region of Human INO80C. Synthetic peptide located within the following region: VATTSTPGIVRNSKKRPASPSHNGSSGGGYGASKKKKASASSFAQGISME. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | INO80C |
Supplier Page | Shop |