IRX6 / IRXB3 antibody
| Name | IRX6 / IRXB3 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA329921 |
| Prices | $325.00 |
| Sizes | 100 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Mouse |
| Antigen | The immunogen for anti-IRX6 antibody: synthetic peptide directed towards the C terminal of mouse IRX6. Synthetic peptide located within the following region: RAQSPECHMIPRQPSSIRRLLVPRDSEGEEDSPAAKAFGNSTFTLQGLPL. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | Irx6 |
| Supplier Page | Shop |
Product images
WB Suggested Anti-IRX6 Antibody Titration: 1.25ug/ml; ELISA Titer: 1:12500; Positive Control: NIH/3T3 cell lysate