ISG20L2 antibody
| Name | ISG20L2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA331705 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Human |
| Antigen | The immunogen for Anti-ISG20L2 Antibody is: synthetic peptide directed towards the N-terminal region of Human ISG20L2. Synthetic peptide located within the following region: KVDLLGEFQSALPKINSHPTRSQKKSSQKKSSKKNHPQKNAPQNSTQAHS. |
| Description | Rabbit Polyclonal |
| Gene | ISG20L2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: ISG20L2; Sample Tissue: MCF7 Whole Cell lysates; Antibody Dilution: 1.0ug/mlISG20L2 is strongly supported by BioGPS gene expression data to be expressed in Human MCF7 cells