IZUMO2 antibody

Name IZUMO2 antibody
Supplier Acris Antibodies
Catalog TA337364
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Human
Antigen The immunogen for Anti-IZUMO2 antibody is: synthetic peptide directed towards the C-terminal region of Human IZUMO2. Synthetic peptide located within the following region: CIHKKYCFVDRQPRVALQYQMDSKYPRNQALLGILISVSLAVFVFVVIVV.
Purity/Format Affinity Purified
Description Rabbit Polyclonal
Gene IZUMO2
Supplier Page Shop

Product images