Name | KBTBD6 antibody |
---|---|
Supplier | Acris Antibodies |
Catalog | TA337369 |
Prices | $325.00 |
Sizes | 50 µg |
Host | Rabbit |
Clonality | Polyclonal |
Isotype | IgG |
Applications | WB |
Species Reactivities | Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Pig, Rat |
Antigen | The immunogen for Anti-KBTBD6 antibody is: synthetic peptide directed towards the N-terminal region of Human KBTBD6. Synthetic peptide located within the following region: QSREDAPRSRRLASPRGGKRPKKIHKPTVSAFFTGPEELKDTAHSAALLA. |
Purity/Format | Affinity Purified |
Description | Rabbit Polyclonal |
Gene | KBTBD6 |
Supplier Page | Shop |