KCNS1 antibody

Name KCNS1 antibody
Supplier Acris Antibodies
Catalog TA338531
Prices $325.00
Sizes 50 µg
Host Rabbit
Clonality Polyclonal
Isotype IgG
Applications WB
Species Reactivities Bovine, Dog, Horse, Guinea Pig, Human, Mouse, Rabbit, Rat, Zebrafish
Antigen The immunogen for anti-KCNS1 antibody: synthetic peptide directed towards the N terminal of human KCNS1. Synthetic peptide located within the following region: LCDDYDEAAREFYFDRHPGFFLSLLHFYRTGHLHVLDELCVFAFGQEADY.
Purity/Format Protein A purified
Description Rabbit Polyclonal
Gene KCNS1
Supplier Page Shop

Product images