KDELC2 antibody
| Name | KDELC2 antibody |
|---|---|
| Supplier | Acris Antibodies |
| Catalog | TA334314 |
| Prices | $325.00 |
| Sizes | 50 µg |
| Host | Rabbit |
| Clonality | Polyclonal |
| Isotype | IgG |
| Applications | WB |
| Species Reactivities | Dog, Horse, Guinea Pig, Human, Pig, Rat, Zebrafish |
| Antigen | The immunogen for anti-KDELC2 antibody is: synthetic peptide directed towards the middle region of Human KDELC2. Synthetic peptide located within the following region: SWINKTERAFFRGRDSREERLQLVQLSKENPQLLDAGITGYFFFQEKEKE. |
| Purity/Format | Affinity Purified |
| Description | Rabbit Polyclonal |
| Gene | KDELC2 |
| Supplier Page | Shop |
Product images
Host: Rabbit; Target Name: KDELC2; Sample Tissue: PANC1 Whole Cell lysates; Antibody Dilution: 1.0 ug/ml